Travel Collections
All photos are available for purchase as Limited Edition full-color prints. I use an archival 100% cotton fine art paper Photo Rag Baryta by Hahnemühle with an inkjet coating, giving it a high-gloss finish and standards that guarantee long-lasting color and saturation. Each print comes with a Certificate of Authenticity, indicating that you have purchased my original work. Each print is hand-signed, numbered, titled, and dated on the 1" white border. All prints are shipped rolled in a protective hard PVC tube to any country worldwide.
Soundless Flight
Inspiration for this work struck while I was in Galveston, Texas, USA. The sun was setting, bathing the beach in glowing orange and yellow and pink. Seagulls clamored for my attention: feeding one led to another, and another, until I was surrounded by them, their wings glinting with color. I found myself mesmerized by the way they flew, how they cut such precise shapes against the darkening sky, and I knew I needed to capture that moment.
It took several trips before I found the perfect shot. One bird unmistakable in the foreground, another out of focus behind it, both caught in the last bright orange stripe of dying light. They were level with my eyes as I brought my camera up to snap the picture that would be the foundation of my creation. There's harmony in the colors I see here, a unity flowing between the beady glint of the seagull's eyes and the blending of colors, from orange to maroon to black.
Looking at this art, I see freedom. A carefree flight, a sense of nonchalance that every grounded creature envies. I feel the weight of gravity, and I know that while I can't join the avian life populating our world, I will find my own liberation.Soundlessflightairaircraftairfoilairplaneatmospherebirdcloudcloudsdeviceequipmentflyflyingfreedomhighjetmechanismparachuteplanepropellerrescue equipmentroperotorskysummersunsunsettravelwingwings
Fête des Tuileries
I was in Paris in 2019, unaware that soon there will be travel restrictions due to COVID and people will be stuck in their houses. As I walked around Paris, I found myself entranced afresh by this shining city of many colors, and even the sky was blues, yellows, pinks, and even oranges.
I took this shot from the Carrousel du Louvre, located right in the heart of Paris, in the first arrondissement of the City of Lights, which is, without doubt, a premier shopping destination. It is home to various restaurants and more than 40 premium stores, including Apple Store (the first Apple Store in Paris) and Printemps du Louvre (showcasing leading luxury brands with top-of-the-range watchmaking on the mezzanine floor).
“Fête des Tuileries”, a funfair that runs from June to August in th Tuileries Garden. I took this shot from the Carrousel du Louvre, located right in the heart of Paris. The Tuileries Gardens take their name from the tile factories which previously stood on the site where Queen Catherine de Medici built the Palais des Tuileries in 1564. André Le Nôtre, the famous gardener of King Louis XIV, re-landscaped the gardens in 1664 to give them their current French formal garden style. The gardens, which separate the Louvre from the Place de la Concorde, are a pleasant place for walking and culture for Parisians and tourists; Maillol statues stand alongside Rodin or Giacometti. The gardens’ two ponds are perfect places to relax by.Elephant Gate
Elephant Gate of the Mysore Palace is commonly described as Indo-Saracenic mode of architecture. The architecture of Mysore Place is a perfect blend together with Hindu Culture, Muslim Culture, Rajput Culture, and Gothic styles of architecture.
Elephant Gate in Mysore Palace has five entry points. The brass gate of ornate is the main doorway to the Mysore Palace. Elephant gate faces towards east which known as Ane Bagilu. All ceremonial processions began outside this Elephant gate amidst a kaleidoscope of colour and the swirling sounds of marching bands, regiments of soldiers, decorated elephants and camels, garlands of flowers, heraldic insignia royal flags and sacred umbrellas of the king riding in his Golden Howdah atop elephant would travel through this corridor and head on into town.
The coat of the royal family is skilfully interwoven into the delicate foliage on both the gates. The two lions with elephant heads flank a heraldic crest containing a double-headed eagle. The lion is symbolizing power and royalty, and the elephant strength.
The motto in Sanskrit Language reads "Satyamevoddharamyaham", means "I uphold only the truth" Ghadaberunda, the double headed eagle sits regally on top of both gates. This is the emblem of royal family of Mysore in Karnataka. The mounted heads of two elephants shot in local forests by the king in 1955.Jayamarthanda Gate is the grandest of all gates in the city.
History says that Wadiyars began their religious rituals from this gate like welcoming the Royal Horse, Royal Elephant, Royal Cow or bringing a palanquin inside. Even today, the practice is followed with Dasara elephants being brought into the Palace through this gate after traditional rituals.
The gate was also used by the Maharajas to travel towards Chamundi Hill or Lalitha Mahal Palace. Near to it are the temples of Goddess Gayathri and Lord Trineshwara inside the Palace premises. Jayamarthanda Gate is open only once in a year to welcome the Dasara Elephants into the Palace. It is closed for visitors at all other times.
The structure's beauty comes alive when over lakh bulbs are switched on.
Mysore Palace is a popular tourist attraction in Mysore, India. The palace is illuminated with lights on Sundays and public holidays from 7 p.m. to 7.45 p.m., but tourists or groups interested in viewing the illuminated palace on days other than Sunday and public holidays can pay Rs. 50,000 to the Board in advance and get the palace illuminated exclusively for themselves at a convenient time. The Mysore Palace is one of the largest royal palaces in India. The Mysore Palace is famous for its annual Dasara festival when it is decorated with lights and flowers.
#india #indiaclicks #indian #travel #travelgram #instagood #southasia #indiapictures #indiatravelgram #indiatravel #incredibleindia #explorekarnataka #exploreindia #southindia #indiaphotography #discover_india #karnataka #mysore #mysuru #mysorepalace #mysorestyle #royal #ambavilasJayamarthandaGateThegrandestallgatescity.00045507AmbaDasaraIlluminatedLightsRsSundaySundaysTouristVilasadvancealiveambavilasannualarchartattractionbeautyboardbody of waterbuildingbulbscityclassical architecturecolumncomesconvenientdaysdecorateddiscovereveningexclusivelyexploreindiaexplorekarnatakafacadefamousfestivalfinialflowersgetgroupshistoric siteholidaysholy placesincredibleindiaindiaindiaclicksindianindiaphotographyindiapicturesindiatravelindiatravelgraminstagoodinteresteditskarnatakalakhlandmarklargestmmedieval architecturemetropolismysoremysorepalacemysorestylemysurunightppalacepalacespayplace of worshippopularpublicreflectionroyalsskysouthasiasouthindiaspirestructureswitchedsymmetrytemplethanthemselvestimetourismtouriststraveltravelgramviewingwaterwaterway
Amba Vilas Palace
The structure's beauty comes alive when over lakh bulbs are switched on.
Mysore Palace is a popular tourist attraction in Mysore, India. The palace is illuminated with lights on Sundays and public holidays from 7 p.m. to 7.45 p.m., but tourists or groups interested in viewing the illuminated palace on days other than Sunday and public holidays can pay Rs. 50,000 to the Board in advance and get the palace illuminated exclusively for themselves at a convenient time. The Mysore Palace is one of the largest royal palaces in India. The Mysore Palace is famous for its annual Dasara festival when it is decorated with lights and flowers.
#india #indiaclicks #indian #travel #travelgram #instagood #southasia #indiapictures #indiatravelgram #indiatravel #incredibleindia #explorekarnataka #exploreindia #southindia #indiaphotography #discover_india #karnataka #mysore #mysuru #mysorepalace #mysorestyle #royal #ambavilasAmbaVilaspalace00045507DasaraIlluminatedLightsRsSundaySundaysTheTouristadvancealiveambavilasannualarchartattractionbeautyboardbody of waterbuildingbulbscityclassical architecturecolumncomesconvenientdaysdecorateddiscovereveningexclusivelyexploreindiaexplorekarnatakafacadefamousfestivalfinialflowersgetgroupshistoric siteholidaysholy placesincredibleindiaindiaindiaclicksindianindiaphotographyindiapicturesindiatravelindiatravelgraminstagoodinteresteditskarnatakalakhlandmarklargestmmedieval architecturemetropolismysoremysorepalacemysorestylemysurunightppalacespayplace of worshippopularpublicreflectionroyalsskysouthasiasouthindiaspirestructureswitchedsymmetrytemplethanthemselvestimetourismtouriststraveltravelgramviewingwaterwaterway
Golden Throne - Golden Howdah made of 80 Kgs of Gold
The core of this Howdah is a wooden structure in the form of a mandapa which is covered with 80 Kg of Gold Sheets having intricate designs consisting of scrolls, foliage, and flowers. The focus of the Dasara Procession’s grand finale. On either side of the Howdah are two ivory fly whisks, finely-cut strips of ivory form the bristles, which are tipped with zari, a type of thread made from thinnest gold or silver wire.
Two Lights attached to the Howdah are red and green, are battery-operated, and used to control the pace of the procession by the King. King would customarily stop to receive floral offerings from his subjects. The elephant would lift the garland to the King, who would touch the flower then the elephant would hand it back. During the days of yore, the King would sit in the Howdah accompanied by his brother and nephew. Sri Jayachamarajendra Wadiyar is the last royal family member to ride in Golden Howdah. Seven cannons were fired to make momentous events. The tradition of the Dasara Procession continues to this day also but the idol of the presiding deity of the Mysuru city, Goddess Chamundeshwari, is taken in procession in the Golden Howdah.
Mysore Palace is a popular tourist attraction in Mysore, India. The palace is illuminated with lights on Sundays and public holidays from 7 p.m. to 7.45 p.m., but tourists or groups interested in viewing the illuminated palace on days other than Sunday and public holidays can pay Rs. 50,000 to the Board in advance and get the palace illuminated exclusively for themselves at a convenient time. The Mysore Palace is one of the largest royal palaces in India. The Mysore Palace is famous for its annual Dasara festival when it is decorated with lights and flowers.
#india #indiaclicks #indian #travel #travelgram #instagood #southasia #indiapictures #indiatravelgram #indiatravel #incredibleindia #explorekarnataka #exploreindia #southindia #indiaphotography #discover_india #karnataka #mysore #mysuru #mysorepalace #mysorestyle #royal #ambavilas #fabulousshot #colors #colorpallete #colorscheme #colorharmony #paletteharmony #showyourwork #showyoursketchbook #favoritecolors #Kreativelens #Kreativelens_artGoldenThroneHowdahmadeKgsGold00045507AmbaDasaraIlluminatedLightsRsSundaySundaysTheTouristVilasadvancealiveambavilasannualarchartattractionbeautyboardbody of waterbuildingbulbscityclassical architecturecolumncomesconvenientdaysdecorateddiscovereveningexclusivelyexploreindiaexplorekarnatakafacadefamousfestivalfinialflowersgetgroupshistoric siteholidaysholy placesincredibleindiaindiaindiaclicksindianindiaphotographyindiapicturesindiatravelindiatravelgraminstagoodinteresteditskarnatakalakhlandmarklargestmmedieval architecturemetropolismysoremysorepalacemysorestylemysurunightppalacepalacespayplace of worshippopularpublicreflectionroyalsskysouthasiasouthindiaspirestructureswitchedsymmetrytemplethanthemselvestimetourismtouriststraveltravelgramviewingwaterwaterway
Mysore Palace Ceiling
The Mysore Palace is home to many intricate carvings, including some in Burma Teak Wood. The use of teak wood was not just for ornamentation but also to keep the rooms cool and reduce the echo within. The Mysore Palace is a beautiful example of Indian architecture and craftsmanship. Visitors to the palace can see the intricate carvings up close and appreciate the skill that went into their creation.
#india #indiaclicks #indian #travel #travelgram #instagood #southasia #indiapictures #indiatravelgram #indiatravel #incredibleindia #explorekarnataka #exploreindia #southindia #indiaphotography #discover_india #karnataka #mysore #mysuru #mysorepalace #mysorestyle #royal #ambavilas #fabulousshot #colors #colorpallete #colorscheme #colorharmony #paletteharmony #showyourwork #showyoursketchbook #favoritecolors #Kreativelens #Kreativelens_art #ThrillingTravelMysore Palace Public Durbar.
Public Durbar Hall is one of the most beautifully decorated rooms. The Maharaja occupied the center of this hall so that his subjects could see him. Around him, on either side are green balconies where the ministers and dignitaries sat as per their status. The general public would occupy the central grounds below.
This hall is supported on granite pillars and roofed with a fine stucco ceiling adorned with various designs. The rear walls of this sizeable pillared hall contain one oil painting of Sita Swaymvara created by the celebrated south Indian royal artist from Kerala, Raja Ravi Varma. In the center is a picture of Trimurti – Lord Shiva, Brahma, and Vishnu surrounded by 12 zodiac signs.
#india #indiaclicks #indian #travel #travelgram #instagood #southasia #indiapictures #indiatravelgram #indiatravel #incredibleindia #explorekarnataka #exploreindia #southindia #indiaphotography #discover_india #karnataka #mysore #mysuru #mysorepalace #mysorestyle #royal #ambavilas #fabulousshot #colors #colorpallete #colorscheme #colorharmony #paletteharmony #showyourwork #showyoursketchbook #favoritecolors #Kreativelens #Kreativelens_art #ThrillingTravelAmba Vilas Durbar Hall
If the Public Durbar Hall had you awe-struck, wait till you see the private durbar hall -also, called Amba Vilas Durbar Hall. It is in this ostentatious hall that the King met his council of ministers and had meetings with important dignitaries. Build to impress, every aspect of this hall has a tale to share. Let’s start with the blue and gold pillars that are made of wrought iron and are hollow to absorb sound better. This is exactly opposite of the granite green -gold ones in the public durbar hall that would reflect sound. The gold used in the pillars is real and the paint in the hall has never been changed or touched upon. This is how it has been for the last century or so. The almost to floor chandeliers adds to the ornamental appeal of the hall. While those hang from a glass ceiling, the rest of the hall had the same teak wood roof that reduced the noise levels. #india #indiaclicks #indian #travel #travelgram #instagood #southasia #indiapictures #indiatravelgram #indiatravel #incredibleindia #explorekarnataka #exploreindia #southindia #indiaphotography #discover_india #karnataka #mysore #mysuru #mysorepalace #mysorestyle #royal #ambavilas #fabulousshot #colors #colorpallete #colorscheme #colorharmony #paletteharmony #showyourwork #showyoursketchbook #favoritecolors #Kreativelens #Kreativelens_art #ThrillingTravel
Amba Vilas Durbar Hall
The private durbar hall, also called Amba Vilas Durbar Hall, is this ostentatious hall where the King met his council of ministers and had meetings with important dignitaries. Most gorgeously decorated hall, with a harmonious composition in colors. Build to impress, every aspect of this hall has a tale to share. Let’s start with the blue and gold pillars made of wrought iron and hollow to absorb sound better. This is precisely opposite to the granite green-gold ones in the public durbar hall that would reflect sound. The gold used in the pillars is pure gold, and the hall's paint has never been changed or touched upon. This is how it has been for the last century or so. The beauty of many of the details is unsurpassed in the palace. The paintwork in the public durbar hall is predominantly blue and gold here. The ceilings in the corridor surrounding the atrium are carved in teak. The use of teak wood was not just for ornamentation but also to keep the rooms cool and reduce the echo within. Between these pillars, the floor is made with marble and has the same inlay work as what you see at the Taj Mahal. In fact, pietra-dura artists from Agra were called in for this work. The Mysore Palace is a beautiful example of Indian architecture and craftsmanship. Visitors to the palace can see the intricate carvings up close and appreciate the skill that went into their creation.
#india #indiaclicks #indian #travel #travelgram #instagood #southasia #indiapictures #indiatravelgram #indiatravel #incredibleindia #explorekarnataka #exploreindia #southindia #indiaphotography #discover_india #karnataka #mysore #mysuru #mysorepalace #mysorestyle #royal #ambavilas #fabulousshot #colors #colorpallete #colorscheme #colorharmony #paletteharmony #showyourwork #showyoursketchbook #favoritecolors #Kreativelens #Kreativelens_art #ThrillingTravelAmba Vilas Palace
Mysore Palace is a must-visit if you're ever in the city. The Public Durbar Hall, in particular, is breathtaking. It's 155 feet and 42 feet in width, with green and gold arches and bottle-shaped columns in different hues. Every detail is exquisite. No matter how often I see it, the Public Durbar Hall always takes my breath away.
#india #indiaclicks #indian #travel #travelgram #instagood #southasia #indiapictures #indiatravelgram #indiatravel #incredibleindia #explorekarnataka #exploreindia #southindia #indiaphotography #discover_india #karnataka #mysore #mysuru #mysorepalace #mysorestyle #royal #ambavilasAmbaVilaspalace00045507DasaraIlluminatedLightsRsSundaySundaysTheTouristadvancealiveambavilasannualarchartattractionbeautyboardbody of waterbuildingbulbscityclassical architecturecolumncomesconvenientdaysdecorateddiscovereveningexclusivelyexploreindiaexplorekarnatakafacadefamousfestivalfinialflowersgetgroupshistoric siteholidaysholy placesincredibleindiaindiaindiaclicksindianindiaphotographyindiapicturesindiatravelindiatravelgraminstagoodinteresteditskarnatakalakhlandmarklargestmmedieval architecturemetropolismysoremysorepalacemysorestylemysurunightppalacespayplace of worshippopularpublicreflectionroyalsskysouthasiasouthindiaspirestructureswitchedsymmetrytemplethanthemselvestimetourismtouriststraveltravelgramviewingwaterwaterway
Wood Inlay
Wood inlay is the process of decorating the surface of wood by setting it in pieces of material such as ivory, bone, plastic, or wood of different colors. This craft is concentrated in Mysore and Bangalore in Karnataka, where its roots can be traced back to a family by the name of Mirza Yousuf Ali, was a pioneer in the field. The artisan smoothens the base of the rosewood and the design is traced and etched into the surface. The several components of the inlay are painstakingly assembled to match and fit exactly into the grooves and are then glued in. The design is finished by obtaining the required shades with several coats of polish. The doors of the Amba Vilas palace in Mysore are also fine examples of inlay.
Wood Inlay
Wood inlay is the process of decorating the surface of wood by setting it in pieces of material such as ivory, bone, plastic, or wood of different colors. This craft is concentrated in Mysore and Bangalore in Karnataka, where its roots can be traced back to a family by the name of Mirza Yousuf Ali, was a pioneer in the field. The artisan smoothens the base of the rosewood and the design is traced and etched into the surface. The several components of the inlay are painstakingly assembled to match and fit exactly into the grooves and are then glued in. The design is finished by obtaining the required shades with several coats of polish. The doors of the Amba Vilas palace in Mysore are also fine examples of inlay.
Jumeirah Mosque
It is among the few mosques that are open for non-Muslims to visit. Although Christians and Jews believe in the God of Abraham, they are not allowed to perform the hajj. Indeed, the government of Saudi Arabia forbids all non-Muslims from entering the holy city of Mecca at all. In Mecca, only Muslims are allowed, while non-Muslims may not enter or pass through. Attempting to enter Mecca as a non-Muslim can result in penalties such as a fine; being in Mecca as a non-Muslim can result in deportation.
#yearofthefiftieth #dubai #dubailife #mydubai #love #instagood #summer #photooftheday #instalike #travel #family #instapic #holiday #beautifuljumeirahMosqueAbrahamAttemptingChristiansDubaiInItJewsMeccaMuslimMuslimsSaudiallowedarabiaarcadearchartbeautifulbeingbelievebuildingbyzantine architecturecityclassical architectureclouddaytimedeportationdomedubailifeenterenteringfacadefamilyfewfineforbidsgodgovernmenthajjhistoric siteholidayholyholy placesinstagoodinstalikeinstapickhanqahlandmarklovemedieval architecturemonumentmosquesmydubainonopenpasspenaltiesperformphotoofthedayplace of worshipresultskysummersymmetrytempletheythroughtraveltreevisitwindowworldyearofthefiftieth
Jumeirah Majlis
A quaint little cafe offers traditional camel milk fare and a glimps of history.
Majlis, is an Arabic term meaning "a place of sitting", used in the context of "council", to describe various types of special gatherings among common interest groups be it administrative, social or religious in countries with linguistic or cultural connections to Islamic countries.
#yearofthefiftieth #dubai #dubailife #mydubai #love #instagood #summer #photooftheday #instalike #travel #family #instapic #holiday #beautifuljumeirahMajlisAbrahamAttemptingChristiansDubaiInItJewsMeccaMosqueMuslimMuslimsSaudiallowedarabiaarcadearchartbeautifulbeingbelievebuildingbyzantine architecturecityclassical architectureclouddaytimedeportationdomedubailifeenterenteringfacadefamilyfewfineforbidsgodgovernmenthajjhistoric siteholidayholyholy placesinstagoodinstalikeinstapickhanqahlandmarklovemedieval architecturemonumentmosquesmydubainonopenpasspenaltiesperformphotoofthedayplace of worshipresultskysummersymmetrytempletheythroughtraveltreevisitwindowworldyearofthefiftieth
Golden Dubai
The percentage of foreigners in the UAE is over 88%. Most foreigners in Dubai are construction workers from India, Bangladesh, and Pakistan.
@emaardubai @downtowndubai @dubaimarinamall @dubai #cityview #dubai #cityscape #city #artsy #artistic #instalike #instagood #moodygrams #buildings #skyscrapers #fujifilm #vsco #vscoedit #vscodaily #fotografia #instagram #moodyedits #starwars #followparty #visualambassadors #streetphoto #citylife #quarantine #stayathome #dubai #abudhabi #uae #unitedarabemirates #emirates #luxury #travel #burjalarab #burjkhalifa #dubaimall #palmisland #jumeirah #beach #thepalm #arab #travel #yasisland #saadiyatisland #jebelali #desert #sexandthecity2 #palace #arabia #modern #sheikh #ferrariworld #thewave #instagood #traveldubai #jumeirahmedinatgoldenDubai88BangladeshInstagramPakistanTheUAEabudhabiarabarabiaartisticartsybeachbuildingbuildingsburjalarabburjkhalifacitycitylifecityscapecityviewcommercial buildingcondominiumconstructiondarknessdaytimedesertdowntowndubaidubaimalldubaimarinamallelectricityemaardubaiemiratesfacadeferrariworldfollowpartyforeignersfotografiafujifilmindiainstagoodinstalikejebelalijumeirahjumeirahmedinatlakeluxurymetropolismidnightmixedusemodernmoodyeditsmoodygramsnaturepalacepalmislandpercentagequarantinereflectionsaadiyatislandsexandthecity2sheikhskyskyscraperskyscrapersspacestarwarsstayathomestreetphotosymmetrythepalmthewavetowertower blocktraveltraveldubaitreeunitedarabemiratesvisualambassadorsvscovscodailyvscoeditwaterwaterwayworkersworldyasisland
Golden Dubai - Burj Khalifa
It took 22 million man-hours to complete the Burj Khalifa, the percentage of foreigners in the UAE is over 88%. Most foreigners in Dubai are construction workers from India, Bangladesh, and Pakistan.
@emaardubai @downtowndubai @dubaimarinamall @dubai #picoftheday #instagraphy #burjkhalifa #downtowndubai #dxb #dubaimall #instadaily #dubai #uae2022 #dubaicity #dubaitourism #dubaipics #dubaiskyline #citylandscape #citygram #uaelifestyle #worldbestcities #raw_cityscapes #mydubai🇦🇪 #picsdubai #weloveemirates #dubaimarina #exploredubai #citybestpics #citybestviews #cityview #amazingdubaigoldenDubaiBurjKhalifa88BangladeshInstagramPakistanTheUAEabudhabiarabarabiaartisticartsybeachbuildingbuildingsburjalarabburjkhalifacitycitylifecityscapecityviewcommercial buildingcondominiumconstructiondarknessdaytimedesertdowntowndubaidubaimalldubaimarinamallelectricityemaardubaiemiratesfacadeferrariworldfollowpartyforeignersfotografiafujifilmindiainstagoodinstalikejebelalijumeirahjumeirahmedinatlakeluxurymetropolismidnightmixedusemodernmoodyeditsmoodygramsnaturepalacepalmislandpercentagequarantinereflectionsaadiyatislandsexandthecity2sheikhskyskyscraperskyscrapersspacestarwarsstayathomestreetphotosymmetrythepalmthewavetowertower blocktraveltraveldubaitreeunitedarabemiratesvisualambassadorsvscovscodailyvscoeditwaterwaterwayworkersworldyasisland
Expo2020 - Dubai
World Expo hosted by Dubai, in the United Arab Emirates, from 1 October 2021 to 31 March 2022. Originally scheduled for 20 October 2020 to 10 April 2021, it was postponed due to the COVID-19 pandemic. This is the first expo to be held in the Middle East, Africa and South Asia (MEASA) region.
#expo2020 #expo2020dubai #expodubai #dubai #uae @expo2020dubaiExpo2020Dubai110192020202021202231AfricaAprilAsiaCOVIDEastFunMEASAMarchOriginallyThisUAEamusement ridearabautomotive wheel systemcirclecityclouddarknesselectric blueelectricityemirateseventexpoexpo2020dubaiexpodubaiferris wheelheldhostedleisurelightmetropolismetropolitan areamiddlemidnightoctoberpandemicplantpolepostponedrecreationregionscheduledskysouthspacetreeunitedurban areawaswaterwheelworld
Golden Dubai - Burj Khalifa Lake
The Dubai Fountain, located right next to the Dubai Mall, in the middle of Burj Khalifa Lake, was designed by WET Design, who also designed the Bellagio Fountain in Las Vegas
@emaardubai @downtowndubai @dubaimarinamall @dubai #cityview #dubai #cityscape #city #artsy #artistic #instalike #instagood #moodygrams #buildings #skyscrapers #fujifilm #vsco #vscoedit #vscodaily #fotografia #instagram #moodyedits #starwars #followparty #visualambassadors #streetphoto #citylife #quarantine #stayathome #dubai #abudhabi #uae #unitedarabemirates #emirates #luxury #travel #burjalarab #burjkhalifa #dubaimall #palmisland #jumeirah #beach #thepalm #arab #travel #yasisland #saadiyatisland #jebelali #desert #sexandthecity2 #palace #arabia #modern #sheikh #ferrariworld #thewave #instagood #traveldubai #jumeirahmedinatgoldenDubaiBurjKhalifalake88BangladeshInstagramPakistanTheUAEabudhabiarabarabiaartisticartsybeachbuildingbuildingsburjalarabburjkhalifacitycitylifecityscapecityviewcommercial buildingcondominiumconstructiondarknessdaytimedesertdowntowndubaidubaimalldubaimarinamallelectricityemaardubaiemiratesfacadeferrariworldfollowpartyforeignersfotografiafujifilmindiainstagoodinstalikejebelalijumeirahjumeirahmedinatluxurymetropolismidnightmixedusemodernmoodyeditsmoodygramsnaturepalacepalmislandpercentagequarantinereflectionsaadiyatislandsexandthecity2sheikhskyskyscraperskyscrapersspacestarwarsstayathomestreetphotosymmetrythepalmthewavetowertower blocktraveltraveldubaitreeunitedarabemiratesvisualambassadorsvscovscodailyvscoeditwaterwaterwayworkersworldyasisland
Hatta Dam
Hatta is well known for its dam. This extraordinary location is approximately one hour and forty minutes from the heart of Dubai, through magnificent desert dunes. The dam is located in the middle of the rocky mountains and its turquoise waters are a sight to behold. The Hatta Dam is the ideal escape for those who love nature and are tired of spending their time in Dubai staring at skyscrapers.
#uae #hatta #landscape #hattakayak #hattamountains #hattadam #travel #explore #daysoff #middleeast #uae #worldscoolestwinterchallenge #worldscoolestwinter #worldtraveler #mydubailife #Kreativelens #Kreativelens_travel #Kreativelens_arthattaDamDubaiTheThisTurquoiseUAEapproximatelyartbeholdboats and boatingequipment and suppliescloudcoastcoastal and oceanic landformsdaysoffdesertdunesescapeexploreextraordinaryfortyhattadamhattakayakhattamountainshearthighlandhillhorizonhouridealitsknownkreativelenslakelake districtlandscapelocatedlocationlovemagnificentmiddlemiddleeastminutesmountainmountain rangemountainous landformsmountainsmydubailifenatural landscapenaturereservoirrockysightskyskyscraperssoundspendingstaringtarnterraintheirthosethroughtimetiredtravelvalleywaterwater resourceswatercoursewaterswaterwaywhowildernessworldscoolestwinterworldscoolestwinterchallengeworldtraveler
Cathedral of Christ the King.
Landakotskirkja (Landakot's Church), formally Basilika Krists konungs (The Basilica of Christ the King), is the cathedral of the Catholic Church in Iceland. Often referred to as Kristskirkja (Christ's Church), Landakotskirkja is in the western part of Reykjavík, Iceland's capital city. Landakotskirkja has a distinctively flat top instead of a standard spire. Its architect was Guðjón Samúelsson, who also designed Hallgrímskirkja, a Reykjavik landmark, and Akureyrarkirkja in Akureyri, North Iceland.
•
•
•
•
#catholic #christian #jesus #church #christ #archilovers #catholicchurch #christianity #architecturelovers #bible #building #god #igreja #catholicism #catolico #gospel #architectureporn #romancatholic #faith #pray #architecturephotography #buildingscathedralChristtheKingaltarancientarcharchitecturebuildingcatholicchapelchurchcitycolumncrossfaithfamousgodhistoricholyinteriorlandmarklightoldreligionreligiousroofsaintstonetravelvaultwindowworship
The exterior of the Cathedral of Christ the King.
Landakotskirkja (Landakot's Church), formally Basilika Krists konungs (The Basilica of Christ the King), is the cathedral of the Catholic Church in Iceland. Often referred to as Kristskirkja (Christ's Church), Landakotskirkja is in the western part of Reykjavík, Iceland's capital city. Landakotskirkja has a distinctively flat top instead of a standard spire. Its architect was Guðjón Samúelsson, who also designed Hallgrímskirkja, a Reykjavik landmark, and Akureyrarkirkja in Akureyri, North Iceland.
•
•
•
•
#catholic #christian #jesus #church #christ #archilovers #catholicchurch #christianity #architecturelovers #bible #building #god #igreja #catholicism #catolico #gospel #architectureporn #romancatholic #faith #pray #architecturephotography #buildingscathedralChristtheKingaltarancientarcharchitecturebuildingcatholicchapelchurchcitycolumncrossfaithfamousgodhistoricholyinteriorlandmarklightoldreligionreligiousroofsaintstonetravelvaultwindowworship
Harris County Courthouse - Houston
The Harris County Courthouse of 1910 is one of the courthouse buildings operated by the Harris County, Texas government, in Downtown Houston. It is in the Classical Revival architectural style and has six stories. Two courtrooms inside are two stories each.
The landmark Texaco, Inc. v. Pennzoil, Co. case was held in the 1910 Courthouse. This case resulted in the most significant civil award in history, $10.53 billion from Texaco. Punitive damages were reduced on appeal from $3 billion to $1 billion. Pennzoil attorney Joe Jamail was paid $335 million for his services on the case.HarrisCountyCourthouseHoustonhouston texas tx houstontx houstontexas houstonrealestate houstonphotography houstonstrong houstontexans houstonartist texasforever houstonrealtor htx downtownhouston htown Kreativelens Kreativelens_art
Narthex of the Cathedral Basilica of Saint Louis
As one steps into the narthex of the Cathedral Basilica of Saint Louis, one is immediately transported to another world of intricate beauty and awe-inspiring grandeur. The mosaics that adorn its walls and ceilings are a testament to the artistic prowess of the artisans who meticulously pieced together each tile. These shimmering works of art depict various scenes from the Bible, creating a breathtaking visual tribute to the Christian faith. One particularly striking motif is the symbolic vine, which is woven throughout the cathedral in intricate patterns, representing the life-giving presence of Christ. It is truly a sight to behold and a reminder of the enduring power of faith and art.
The narthex is the entrance hall of the Cathedral Basilica of Saint Louis, a Roman Catholic church in Missouri.
This area is decorated with mosaics depicting the life of Saint Louis IX, the city's patron saint, and archdiocese.
The mosaics were designed and installed by Tiffany glass studios in New York in 1912.
They show scenes from Saint Louis' childhood, coronation, crusades, charity, justice, and death.
Symbols of France, such as the fleur-de-lis and the coat of arms, are included in the mosaics.
The narthex mosaics are part of the enormous 83,000-square-foot mosaic collection in the cathedral, one of the largest in the world.
The barrel-vaulted ceiling is a type of arched ceiling that resembles a half-cylinder.
The ceiling is covered by a swirling green vine, symbolizing Christ as the true vine (John 15:1-5).
The vine represents the life-giving power of Christ and his connection to his followers, who are the branches.
The vine motif is found throughout the Cathedral Basilica of Saint Louis, which is dedicated to Christ and Saint Louis IX.
#romanesquearchitecture #crusaderking #fleurdelis #gatewaytothewest #mosaicmasterpiece #catholicchurch #historiclandmark #stlouiscathedral #mosaicart #tiffanyglass #byzantinebeauty #saintlouisix #cathedralbasilica #liturgicalartsNarthextheCathedralBasilicaSaintLouisAmazingDestinationAwesomePlacesBeautifulDestinationBestDestinationsBestPlaceToGoBestPlacesToGo45CathedralArchitectureCathedralArtCathedralBeautyCathedralCityCathedralGramCathedralLoveCathedralOfTheWorldCathedralPhotographyCathedralViewChristianityChurchArchitectureChurchLifeChurchPhotographyChurchesChurchesOfInstagramChurchesOfTheWorldHistoricalArchitectureHistoricalArtHistoricalCultureHistoricalHeritageHistoricalLandmarkHistoricalMonumentHistoricalPhotographyHistoricalPlacesHistoricalSiteInstatravelJesusChristReligion23TravelAddictTravelMomentsWanderful_PlacesWonderful_PlaceWonderful_PlacesWorldTraveler1adventurechurchhistoricaltraveltravelgramtravelphotographyvacationwanderlust
The Cathedral Basilica of Saint Louis
The Cathedral Basilica of Saint Louis is a stunning example of religious architecture and art in the heart of Missouri. The cathedral, completed in 1914, is the mother church of the Archdiocese of St. Louis and the seat of its archbishop. It is also a minor basilica, a title Pope John Paul II granted in 1997, in recognition of its historical and spiritual significance.
The cathedral's exterior is impressive, with its granite walls, twin spires, and three domes. The design blends Romanesque and Byzantine styles, inspired by the Hagia Sophia in Istanbul and the Church of St. Mark in Venice. The cathedral can accommodate up to 5,000 people and has a length of 365 feet and a width of 204 feet. The central dome rises to a height of 227 feet, while the inner dome has a diameter of 80 feet.
But the cathedral's beauty lies within, where visitors can marvel at the most extensive mosaic collection in the Western Hemisphere. The mosaics cover 83,000 square feet of the interior walls and ceilings and depict scenes from the Old and New Testaments, the lives of the saints, and the history of the Church. The mosaics were created by 20 different artists over 75 years, from 1912 to 1988. They contain more than 41 million glass tesserae, in over 7,000 colors.
The cathedral also boasts a rich collection of stained glass windows, sculptures, altars, chapels, and crypts. The stained glass windows on the balcony level were designed by Robert Frei of St. Louis, and feature geometric patterns and symbols. The main altar, designed by George D. Barnett, is made of marble and bronze and features a baldachino with four columns. The Blessed Sacrament Chapel, also designed by Barnett, has a marble altar with a tabernacle shaped like a miniature cathedral. The All Souls Chapel, designed by Rudolf Scheffler, has a mosaic depicting Christ as the judge of the souls. The crypts beneath the cathedral contain the remains of several archbishops and bishops of St. Louis.
The Cathedral Basilica of Saint Louis is a place of worship, a museum, and a treasure trove of art and history. It is open to visitors daily, except during Mass and special events. Guided tours are available upon request, or visitors can explore the cathedral independently with a brochure or an audio guide. There is also a mosaic museum in the lower level, where visitors can learn more about the process and techniques of creating mosaics.
The Cathedral Basilica of Saint Louis is a must-see attraction for anyone who appreciates beauty, spirituality, and culture. It is a testament to the faith and devotion of generations of Catholics in St. Louis, and a source of inspiration for all who enter its doors.TheCathedralBasilicaSaintLouisAmazingDestinationAwesomePlacesBeautifulDestinationBestDestinationsBestPlaceToGoBestPlacesToGo45CathedralArchitectureCathedralArtCathedralBeautyCathedralCityCathedralGramCathedralLoveCathedralOfTheWorldCathedralPhotographyCathedralViewChristianityChurchArchitectureChurchLifeChurchPhotographyChurchesChurchesOfInstagramChurchesOfTheWorldHistoricalArchitectureHistoricalArtHistoricalCultureHistoricalHeritageHistoricalLandmarkHistoricalMonumentHistoricalPhotographyHistoricalPlacesHistoricalSiteInstatravelJesusChristReligion23TravelAddictTravelMomentsWanderful_PlacesWonderful_PlaceWonderful_PlacesWorldTraveler1adventurechurchhistoricaltraveltravelgramtravelphotographyvacationwanderlust
Narthex of the Cathedral Basilica of Saint Louis
As one steps into the narthex of the Cathedral Basilica of Saint Louis, one is immediately transported to another world of intricate beauty and awe-inspiring grandeur. The mosaics that adorn its walls and ceilings are a testament to the artistic prowess of the artisans who meticulously pieced together each tile. These shimmering works of art depict various scenes from the Bible, creating a breathtaking visual tribute to the Christian faith. One particularly striking motif is the symbolic vine, which is woven throughout the cathedral in intricate patterns, representing the life-giving presence of Christ. It is truly a sight to behold and a reminder of the enduring power of faith and art.
The narthex is the entrance hall of the Cathedral Basilica of Saint Louis, a Roman Catholic church in Missouri.
This area is decorated with mosaics depicting the life of Saint Louis IX, the city's patron saint, and archdiocese.
The mosaics were designed and installed by Tiffany glass studios in New York in 1912.
They show scenes from Saint Louis' childhood, coronation, crusades, charity, justice, and death.
Symbols of France, such as the fleur-de-lis and the coat of arms, are included in the mosaics.
The narthex mosaics are part of the enormous 83,000-square-foot mosaic collection in the cathedral, one of the largest in the world.
The barrel-vaulted ceiling is a type of arched ceiling that resembles a half-cylinder.
The ceiling is covered by a swirling green vine, symbolizing Christ as the true vine (John 15:1-5).
The vine represents the life-giving power of Christ and his connection to his followers, who are the branches.
The vine motif is found throughout the Cathedral Basilica of Saint Louis, which is dedicated to Christ and Saint Louis IX.
#romanesquearchitecture #crusaderking #fleurdelis #gatewaytothewest #mosaicmasterpiece #catholicchurch #historiclandmark #stlouiscathedral #mosaicart #tiffanyglass #byzantinebeauty #saintlouisix #cathedralbasilica #liturgicalartsNarthextheCathedralBasilicaSaintLouisAmazingDestinationAwesomePlacesBeautifulDestinationBestDestinationsBestPlaceToGoBestPlacesToGo45CathedralArchitectureCathedralArtCathedralBeautyCathedralCityCathedralGramCathedralLoveCathedralOfTheWorldCathedralPhotographyCathedralViewChristianityChurchArchitectureChurchLifeChurchPhotographyChurchesChurchesOfInstagramChurchesOfTheWorldHistoricalArchitectureHistoricalArtHistoricalCultureHistoricalHeritageHistoricalLandmarkHistoricalMonumentHistoricalPhotographyHistoricalPlacesHistoricalSiteInstatravelJesusChristReligion23TravelAddictTravelMomentsWanderful_PlacesWonderful_PlaceWonderful_PlacesWorldTraveler1adventurechurchhistoricaltraveltravelgramtravelphotographyvacationwanderlust
The All Saints Chapel
View of the all Saints Chapel from the bay. The bay is the area between the two transepts of the cathedral, where the pews are located. The bay has four soffit arches that span the width of the nave, each with mosaics illustrating different themes: creation, sanctification, priesthood, and redemption. The bay also has eight small domes with mosaics of saints and angels. The historic bay is located near the south dome and features mosaics of American saints, significant events in the Catholic history of St. Louis.
TheAllSaintsChapelAmazingDestinationAwesomePlacesBeautifulDestinationBestDestinationsBestPlaceToGoBestPlacesToGo45CathedralCathedralArchitectureCathedralArtCathedralBeautyCathedralCityCathedralGramCathedralLoveCathedralOfTheWorldCathedralPhotographyCathedralViewChristianityChurchArchitectureChurchLifeChurchPhotographyChurchesChurchesOfInstagramChurchesOfTheWorldHistoricalArchitectureHistoricalArtHistoricalCultureHistoricalHeritageHistoricalLandmarkHistoricalMonumentHistoricalPhotographyHistoricalPlacesHistoricalSiteInstatravelJesusChristReligion23TravelAddictTravelMomentsWanderful_PlacesWonderful_PlaceWonderful_PlacesWorldTraveler1adventurechurchhistoricaltraveltravelgramtravelphotographyvacationwanderlust
The Cathedral Basilica of Saint Louis- The West Transept
The west soffit contains images of Jesus' baptism and Ascension to heaven. The transept mosaic, rendered in flaming colors of red, violet, and blue, pictures the occasion of the Holy Spirit's descent on the apostles, inspiring them to go forth and preach the Word of God. The fourteen stations of the cross are mounted on the plain lower walls of the east and west transepts above the confessionals.
TheCathedralBasilicaSaintLouisWestTranseptAmazingDestinationAwesomePlacesBeautifulDestinationBestDestinationsBestPlaceToGoBestPlacesToGo45CathedralArchitectureCathedralArtCathedralBeautyCathedralCityCathedralGramCathedralLoveCathedralOfTheWorldCathedralPhotographyCathedralViewChristianityChurchArchitectureChurchLifeChurchPhotographyChurchesChurchesOfInstagramChurchesOfTheWorldHistoricalArchitectureHistoricalArtHistoricalCultureHistoricalHeritageHistoricalLandmarkHistoricalMonumentHistoricalPhotographyHistoricalPlacesHistoricalSiteInstatravelJesusChristReligion23TravelAddictTravelMomentsWanderful_PlacesWonderful_PlaceWonderful_PlacesWorldTraveler1adventurechurchhistoricaltraveltravelgramtravelphotographyvacationwanderlust